View source | Discuss this page | Page history | Printable version   
Main Page
Upload file
What links here
Recent changes

PDF Books
Add page
Show collection (0 pages)
Collections help


ERP/3.0/Developers Guide/Reference/Entity Model/FIN Payment Schedule

This article is protected against manual editing because it is automatically generated from Openbravo meta-data. Learn more about writing and translating such documents.
Back button.png   Back to ERP/3.0/Developers_Guide/Reference/Entity_Model#FIN_Payment_Schedule


To the database table (FIN_Payment_Schedule) of this entity.



Property Column Constraints Type Description
id* Fin_Payment_Schedule_ID Mandatory
Max Length: 32
client AD_Client_ID Mandatory
ADClient A Client is a company or a legal entity. You cannot share data between Clients.
organization AD_Org_ID Mandatory
Organization An organization is a unit of your client or legal entity - examples are store, department. You can share data between organizations.
creationDate Created Mandatory
java.util.Date The Created field indicates the date that this record was created.
createdBy Createdby Mandatory
ADUser The Created By field indicates the user who created this record.
updated Updated Mandatory
java.util.Date The Updated field indicates the date that this record was updated.
updatedBy Updatedby Mandatory
ADUser The Updated By field indicates the user who updated this record.
invoice C_Invoice_ID Invoice The Invoice ID uniquely identifies an Invoice Document.
order C_Order_ID Order Unique identifier and a reference to a Sales Order originating from the document sequence defined for this document type.
dueDate# Duedate Mandatory
java.util.Date Date when the payment is due without deductions or discount
finPaymentmethod Fin_Paymentmethod_ID Mandatory
currency C_Currency_ID Mandatory
Currency Indicates the currency to be used when processing this document.
amount# Amount Mandatory
paidAmount Paidamt Mandatory
outstandingAmount Outstandingamt Mandatory
java.math.BigDecimal Outstanding Amount. Amount pending to be paid
active Isactive java.lang.Boolean There are two methods of making records unavailable in the system: One is to delete the record, the other is to de-activate the record. A de-activated record is not available for selection, but available for reporting. There are two reasons for de-activating and not deleting records:

(1) The system requires the record for auditing purposes. (2) The record is referenced by other records. E.g., you cannot delete a Business Partner, if there are existing invoices for it. By de-activating the Business Partner you prevent it from being used in future transactions.

fINPaymentPriority FIN_Payment_Priority_ID FIN_Payment_Priority Sets the priority of the payment plans generated when processing the invoice or order.

The distribution algorithm will be driven by this priority. The pending payments for order or payments will be displayed ordered by the payment priority first and then by the due date.

updatePaymentPlan Update_Payment_Plan java.lang.Boolean Shows a popup where the user can modify some payment plan details.
origDueDate OrigDueDate java.util.Date Due date for the payment plan as per contract
description Description Max Length: 255
java.lang.String A description is limited to 255 characters.
aprmModifPaymentINPlan EM_Aprm_Modif_Paym_Sched Mandatory
aprmModifPaymentOUTPlan EM_Aprm_Modif_Paym_Out_Sched Mandatory
expectedDate ExpectedDate Mandatory
java.util.Date Date when the payment is due without deductions or discount
daysOverdue daysOverDue java.lang.Long
lastPaymentDate LastPaymentDate java.util.Date
numberOfPayments NumberOfPayments java.lang.Long
totalDebtAmount TotalDebtAmount java.math.BigDecimal Doubtful Debt Amount
fINDoubtfulDebtList FIN_Doubtful_Debt
fINDoubtfulDebtVList FIN_Doubtful_Debt_V
fINPaymentDetailVPaymentPlanInvoiceList FIN_Payment_Detail_V
fINPaymentDetailVPaymentPlanOrderList FIN_Payment_Detail_V
fINPaymentScheduleDetailOrderPaymentScheduleList FIN_Payment_ScheduleDetail
fINPaymentScheduleDetailInvoicePaymentScheduleList FIN_Payment_ScheduleDetail

Java Entity Class

  * The contents of this file are subject to the Openbravo  Public  License
  * Version  1.1  (the  "License"),  being   the  Mozilla   Public  License
  * Version 1.1  with a permitted attribution clause; you may not  use this
  * file except in compliance with the License. You  may  obtain  a copy of
  * the License at
  * Software distributed under the License  is  distributed  on  an "AS IS"
  * basis, WITHOUT WARRANTY OF ANY KIND, either express or implied. See the
  * License for the specific  language  governing  rights  and  limitations
  * under the License.
  * The Original Code is Openbravo ERP.
  * The Initial Developer of the Original Code is Openbravo SLU
  * All portions are Copyright (C) 2008-2014 Openbravo SLU
  * All Rights Reserved.
  * Contributor(s):  ______________________________________.
 package org.openbravo.model.financialmgmt.payment;
 import java.math.BigDecimal;
 import java.util.ArrayList;
 import java.util.Date;
 import java.util.List;
 import org.openbravo.base.structure.ActiveEnabled;
 import org.openbravo.base.structure.BaseOBObject;
 import org.openbravo.base.structure.ClientEnabled;
 import org.openbravo.base.structure.OrganizationEnabled;
 import org.openbravo.base.structure.Traceable;
 import org.openbravo.model.common.currency.Currency;
 import org.openbravo.model.common.enterprise.Organization;
 import org.openbravo.model.common.invoice.Invoice;
 import org.openbravo.model.common.order.Order;
  * Entity class for entity FIN_Payment_Schedule (stored in table FIN_Payment_Schedule).
  * NOTE: This class should not be instantiated directly. To instantiate this
  * class the {@link org.openbravo.base.provider.OBProvider} should be used.
 public class FIN_PaymentSchedule extends BaseOBObject implements Traceable, ClientEnabled, OrganizationEnabled, ActiveEnabled {
     private static final long serialVersionUID = 1L;
     public static final String TABLE_NAME = "FIN_Payment_Schedule";
     public static final String ENTITY_NAME = "FIN_Payment_Schedule";
     public static final String PROPERTY_ID = "id";
     public static final String PROPERTY_CLIENT = "client";
     public static final String PROPERTY_ORGANIZATION = "organization";
     public static final String PROPERTY_CREATIONDATE = "creationDate";
     public static final String PROPERTY_CREATEDBY = "createdBy";
     public static final String PROPERTY_UPDATED = "updated";
     public static final String PROPERTY_UPDATEDBY = "updatedBy";
     public static final String PROPERTY_INVOICE = "invoice";
     public static final String PROPERTY_ORDER = "order";
     public static final String PROPERTY_DUEDATE = "dueDate";
     public static final String PROPERTY_FINPAYMENTMETHOD = "finPaymentmethod";
     public static final String PROPERTY_CURRENCY = "currency";
     public static final String PROPERTY_AMOUNT = "amount";
     public static final String PROPERTY_PAIDAMOUNT = "paidAmount";
     public static final String PROPERTY_OUTSTANDINGAMOUNT = "outstandingAmount";
     public static final String PROPERTY_ACTIVE = "active";
     public static final String PROPERTY_FINPAYMENTPRIORITY = "fINPaymentPriority";
     public static final String PROPERTY_UPDATEPAYMENTPLAN = "updatePaymentPlan";
     public static final String PROPERTY_ORIGDUEDATE = "origDueDate";
     public static final String PROPERTY_DESCRIPTION = "description";
     public static final String PROPERTY_APRMMODIFPAYMENTINPLAN = "aprmModifPaymentINPlan";
     public static final String PROPERTY_APRMMODIFPAYMENTOUTPLAN = "aprmModifPaymentOUTPlan";
     public static final String PROPERTY_EXPECTEDDATE = "expectedDate";
     public static final String PROPERTY__COMPUTEDCOLUMNS = "_computedColumns";
     public static final String PROPERTY_FINDOUBTFULDEBTLIST = "fINDoubtfulDebtList";
     public static final String PROPERTY_FINDOUBTFULDEBTVLIST = "fINDoubtfulDebtVList";
     public static final String PROPERTY_FINPAYMENTDETAILVPAYMENTPLANINVOICELIST = "fINPaymentDetailVPaymentPlanInvoiceList";
     public static final String PROPERTY_FINPAYMENTDETAILVPAYMENTPLANORDERLIST = "fINPaymentDetailVPaymentPlanOrderList";
     public static final String PROPERTY_FINPAYMENTSCHEDULEDETAILORDERPAYMENTSCHEDULELIST = "fINPaymentScheduleDetailOrderPaymentScheduleList";
     public static final String PROPERTY_FINPAYMENTSCHEDULEDETAILINVOICEPAYMENTSCHEDULELIST = "fINPaymentScheduleDetailInvoicePaymentScheduleList";
     // Computed columns properties, these properties cannot be directly accessed, they need
     // to be read through _commputedColumns proxy. They cannot be directly used in HQL, OBQuery
     // nor OBCriteria. 
     public static final String COMPUTED_COLUMN_DAYSOVERDUE = "daysOverdue";
     public static final String COMPUTED_COLUMN_LASTPAYMENTDATE = "lastPaymentDate";
     public static final String COMPUTED_COLUMN_NUMBEROFPAYMENTS = "numberOfPayments";
     public static final String COMPUTED_COLUMN_TOTALDEBTAMOUNT = "totalDebtAmount";
     public FIN_PaymentSchedule() {
         setDefaultValue(PROPERTY_CREATIONDATE, new Date());
         setDefaultValue(PROPERTY_UPDATED, new Date());
         setDefaultValue(PROPERTY_AMOUNT, new BigDecimal(0));
         setDefaultValue(PROPERTY_PAIDAMOUNT, new BigDecimal(0));
         setDefaultValue(PROPERTY_OUTSTANDINGAMOUNT, new BigDecimal(0));
         setDefaultValue(PROPERTY_ACTIVE, true);
         setDefaultValue(PROPERTY_UPDATEPAYMENTPLAN, true);
         setDefaultValue(PROPERTY_APRMMODIFPAYMENTINPLAN, false);
         setDefaultValue(PROPERTY_APRMMODIFPAYMENTOUTPLAN, false);
         setDefaultValue(PROPERTY_FINDOUBTFULDEBTLIST, new ArrayList<Object>());
         setDefaultValue(PROPERTY_FINDOUBTFULDEBTVLIST, new ArrayList<Object>());
     public String getEntityName() {
         return ENTITY_NAME;
     public String getId() {
         return (String) get(PROPERTY_ID);
     public void setId(String id) {
         set(PROPERTY_ID, id);
     public Client getClient() {
         return (Client) get(PROPERTY_CLIENT);
     public void setClient(Client client) {
         set(PROPERTY_CLIENT, client);
     public Organization getOrganization() {
         return (Organization) get(PROPERTY_ORGANIZATION);
     public void setOrganization(Organization organization) {
         set(PROPERTY_ORGANIZATION, organization);
     public Date getCreationDate() {
         return (Date) get(PROPERTY_CREATIONDATE);
     public void setCreationDate(Date creationDate) {
         set(PROPERTY_CREATIONDATE, creationDate);
     public User getCreatedBy() {
         return (User) get(PROPERTY_CREATEDBY);
     public void setCreatedBy(User createdBy) {
         set(PROPERTY_CREATEDBY, createdBy);
     public Date getUpdated() {
         return (Date) get(PROPERTY_UPDATED);
     public void setUpdated(Date updated) {
         set(PROPERTY_UPDATED, updated);
     public User getUpdatedBy() {
         return (User) get(PROPERTY_UPDATEDBY);
     public void setUpdatedBy(User updatedBy) {
         set(PROPERTY_UPDATEDBY, updatedBy);
     public Invoice getInvoice() {
         return (Invoice) get(PROPERTY_INVOICE);
     public void setInvoice(Invoice invoice) {
         set(PROPERTY_INVOICE, invoice);
     public Order getOrder() {
         return (Order) get(PROPERTY_ORDER);
     public void setOrder(Order order) {
         set(PROPERTY_ORDER, order);
     public Date getDueDate() {
         return (Date) get(PROPERTY_DUEDATE);
     public void setDueDate(Date dueDate) {
         set(PROPERTY_DUEDATE, dueDate);
     public FIN_PaymentMethod getFinPaymentmethod() {
         return (FIN_PaymentMethod) get(PROPERTY_FINPAYMENTMETHOD);
     public void setFinPaymentmethod(FIN_PaymentMethod finPaymentmethod) {
         set(PROPERTY_FINPAYMENTMETHOD, finPaymentmethod);
     public Currency getCurrency() {
         return (Currency) get(PROPERTY_CURRENCY);
     public void setCurrency(Currency currency) {
         set(PROPERTY_CURRENCY, currency);
     public BigDecimal getAmount() {
         return (BigDecimal) get(PROPERTY_AMOUNT);
     public void setAmount(BigDecimal amount) {
         set(PROPERTY_AMOUNT, amount);
     public BigDecimal getPaidAmount() {
         return (BigDecimal) get(PROPERTY_PAIDAMOUNT);
     public void setPaidAmount(BigDecimal paidAmount) {
         set(PROPERTY_PAIDAMOUNT, paidAmount);
     public BigDecimal getOutstandingAmount() {
         return (BigDecimal) get(PROPERTY_OUTSTANDINGAMOUNT);
     public void setOutstandingAmount(BigDecimal outstandingAmount) {
         set(PROPERTY_OUTSTANDINGAMOUNT, outstandingAmount);
     public Boolean isActive() {
         return (Boolean) get(PROPERTY_ACTIVE);
     public void setActive(Boolean active) {
         set(PROPERTY_ACTIVE, active);
     public PaymentPriority getFINPaymentPriority() {
         return (PaymentPriority) get(PROPERTY_FINPAYMENTPRIORITY);
     public void setFINPaymentPriority(PaymentPriority fINPaymentPriority) {
         set(PROPERTY_FINPAYMENTPRIORITY, fINPaymentPriority);
     public Boolean isUpdatePaymentPlan() {
         return (Boolean) get(PROPERTY_UPDATEPAYMENTPLAN);
     public void setUpdatePaymentPlan(Boolean updatePaymentPlan) {
         set(PROPERTY_UPDATEPAYMENTPLAN, updatePaymentPlan);
     public Date getOrigDueDate() {
         return (Date) get(PROPERTY_ORIGDUEDATE);
     public void setOrigDueDate(Date origDueDate) {
         set(PROPERTY_ORIGDUEDATE, origDueDate);
     public String getDescription() {
         return (String) get(PROPERTY_DESCRIPTION);
     public void setDescription(String description) {
         set(PROPERTY_DESCRIPTION, description);
     public Boolean isAprmModifPaymentINPlan() {
         return (Boolean) get(PROPERTY_APRMMODIFPAYMENTINPLAN);
     public void setAprmModifPaymentINPlan(Boolean aprmModifPaymentINPlan) {
         set(PROPERTY_APRMMODIFPAYMENTINPLAN, aprmModifPaymentINPlan);
     public Boolean isAprmModifPaymentOUTPlan() {
         return (Boolean) get(PROPERTY_APRMMODIFPAYMENTOUTPLAN);
     public void setAprmModifPaymentOUTPlan(Boolean aprmModifPaymentOUTPlan) {
     public Date getExpectedDate() {
         return (Date) get(PROPERTY_EXPECTEDDATE);
     public void setExpectedDate(Date expectedDate) {
         set(PROPERTY_EXPECTEDDATE, expectedDate);
     public Long getDaysOverdue() {
         return (Long) get(COMPUTED_COLUMN_DAYSOVERDUE);
     public void setDaysOverdue(Long daysOverdue) {
         set(COMPUTED_COLUMN_DAYSOVERDUE, daysOverdue);
     public Date getLastPaymentDate() {
         return (Date) get(COMPUTED_COLUMN_LASTPAYMENTDATE);
     public void setLastPaymentDate(Date lastPaymentDate) {
         set(COMPUTED_COLUMN_LASTPAYMENTDATE, lastPaymentDate);
     public Long getNumberOfPayments() {
     public void setNumberOfPayments(Long numberOfPayments) {
         set(COMPUTED_COLUMN_NUMBEROFPAYMENTS, numberOfPayments);
     public BigDecimal getTotalDebtAmount() {
         return (BigDecimal) get(COMPUTED_COLUMN_TOTALDEBTAMOUNT);
     public void setTotalDebtAmount(BigDecimal totalDebtAmount) {
         set(COMPUTED_COLUMN_TOTALDEBTAMOUNT, totalDebtAmount);
     public FIN_PaymentSchedule_ComputedColumns get_computedColumns() {
         return (FIN_PaymentSchedule_ComputedColumns) get(PROPERTY__COMPUTEDCOLUMNS);
     public void set_computedColumns(FIN_PaymentSchedule_ComputedColumns _computedColumns) {
         set(PROPERTY__COMPUTEDCOLUMNS, _computedColumns);
     public List<DoubtfulDebt> getFINDoubtfulDebtList() {
       return (List<DoubtfulDebt>) get(PROPERTY_FINDOUBTFULDEBTLIST);
     public void setFINDoubtfulDebtList(List<DoubtfulDebt> fINDoubtfulDebtList) {
         set(PROPERTY_FINDOUBTFULDEBTLIST, fINDoubtfulDebtList);
     public List<DoubtfulDebtV> getFINDoubtfulDebtVList() {
       return (List<DoubtfulDebtV>) get(PROPERTY_FINDOUBTFULDEBTVLIST);
     public void setFINDoubtfulDebtVList(List<DoubtfulDebtV> fINDoubtfulDebtVList) {
     public List<FIN_PaymentDetailV> getFINPaymentDetailVPaymentPlanInvoiceList() {
     public void setFINPaymentDetailVPaymentPlanInvoiceList(List<FIN_PaymentDetailV> fINPaymentDetailVPaymentPlanInvoiceList) {
     public List<FIN_PaymentDetailV> getFINPaymentDetailVPaymentPlanOrderList() {
     public void setFINPaymentDetailVPaymentPlanOrderList(List<FIN_PaymentDetailV> fINPaymentDetailVPaymentPlanOrderList) {
     public List<FIN_PaymentScheduleDetail> getFINPaymentScheduleDetailOrderPaymentScheduleList() {
     public void setFINPaymentScheduleDetailOrderPaymentScheduleList(List<FIN_PaymentScheduleDetail> fINPaymentScheduleDetailOrderPaymentScheduleList) {
     public List<FIN_PaymentScheduleDetail> getFINPaymentScheduleDetailInvoicePaymentScheduleList() {
     public void setFINPaymentScheduleDetailInvoicePaymentScheduleList(List<FIN_PaymentScheduleDetail> fINPaymentScheduleDetailInvoicePaymentScheduleList) {
     public Object get(String propName) {
       if (COMPUTED_COLUMN_DAYSOVERDUE.equals(propName)) {
         if (get_computedColumns() == null) {
           return null;
         return get_computedColumns().getDaysOverdue();
       if (COMPUTED_COLUMN_LASTPAYMENTDATE.equals(propName)) {
         if (get_computedColumns() == null) {
           return null;
         return get_computedColumns().getLastPaymentDate();
       if (COMPUTED_COLUMN_NUMBEROFPAYMENTS.equals(propName)) {
         if (get_computedColumns() == null) {
           return null;
         return get_computedColumns().getNumberOfPayments();
       if (COMPUTED_COLUMN_TOTALDEBTAMOUNT.equals(propName)) {
         if (get_computedColumns() == null) {
           return null;
         return get_computedColumns().getTotalDebtAmount();
       return super.get(propName);

Retrieved from ""

This page has been accessed 2,123 times. This page was last modified on 5 August 2014, at 13:52. Content is available under Creative Commons Attribution-ShareAlike 2.5 Spain License.